PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10028938m
Common NameEUTSA_v10028938mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 231aa    MW: 26112.5 Da    PI: 9.7535
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10028938mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.21.7e-31958150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyey+
  Thhalv10028938m  9 KRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYA 58
                     79***********************************************8 PP

2K-box102.45.8e-34781735100
            K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      ++ s++e +a+++qqe+akL+++i+++q+++R+l+G++L+sLs+keL+q+e++Lek++++iRskK+elll++ie+lqk+e el++e  +Lr+k+
  Thhalv10028938m  78 NTHSVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLSVKELKQVENRLEKAISRIRSKKHELLLAEIENLQKREIELDNESIYLRTKI 171
                      34459999*************************************************************************************9 PP

            K-box  99 ee 100
                      +e
  Thhalv10028938m 172 AE 173
                      86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.0E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.034161IPR002100Transcription factor, MADS-box
CDDcd002656.43E-43276No hitNo description
SuperFamilySSF554553.79E-33283IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-333859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-2486171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.46287177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFST RGRLYEYANN  60
NIRSTIERYK KASSDGTNTH SVQEINAAYY QQESAKLRQQ IQTIQNSNRN LMGDSLSSLS  120
VKELKQVENR LEKAISRIRS KKHELLLAEI ENLQKREIEL DNESIYLRTK IAEIERFQHH  180
HQMVSGTEIN AMEALAARNY FAHSIIASGS GSGAGHGCSY SDPDKKIHLG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-22173173Myocyte-specific enhancer factor 2B
1tqe_Q8e-22173173Myocyte-specific enhancer factor 2B
1tqe_R8e-22173173Myocyte-specific enhancer factor 2B
1tqe_S8e-22173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5517670.0EU551767.1 Capsella bursa-pastoris SEEDSTICK-like protein (STKb) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006397127.11e-168hypothetical protein EUTSA_v10028938mg
SwissprotQ388361e-142AGL11_ARATH; Agamous-like MADS-box protein AGL11
TrEMBLV4KL181e-168V4KL18_EUTSA; Uncharacterized protein
STRINGBra037895.1-P1e-156(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49942234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.11e-138MIKC_MADS family protein